Structure of PDB 3mum Chain P Binding Site BS01

Receptor Information
>3mum Chain P (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Ligand information
>3mum Chain R (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucacgcacagagcaaaccauucgaaagagugggacgcaaagccuccgg
ccuaaaccauugcacuccgguagguagcgggguuaccgaugg
.....<.......<<...<<<<<<....>>>>>>...>>...<<<.<<<<
<<<..<<<..........>>>>>>>..>>>>>>....>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mum Structural and biochemical determinants of ligand binding by the c-di-GMP riboswitch .
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 L49 K50 M51 R52 G53 Q54 T89 S91 D92
Binding residue
(residue number reindexed from 1)		Y7 N9 N10 E13 L43 K44 M45 R46 G47 Q48 T83 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3mum, PDBe:3mum, PDBj:3mum
PDBsum3mum
PubMed20690679
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]