Structure of PDB 3e3q Chain P Binding Site BS01

Receptor Information

>3e3q Chain P (length=175) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVP
WMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYG
CDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQA
GAAEYYRAYLEGECVEWLHRYLKNG

Ligand information

>3e3q Chain T (length=9) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QLSPFPFDL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3e3q Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	Y7 R62 I63 Q70 W73 N77 Y84 R97 Y99 T143 K146 W147 A152 Y155 Y156 Y159 E163 W167
Binding residue (residue number reindexed from 1)	Y7 R62 I63 Q70 W73 N77 Y84 R97 Y99 T143 K146 W147 A152 Y155 Y156 Y159 E163 W167

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3e3q, PDBe:3e3q, PDBj:3e3q
PDBsum	3e3q
PubMed	18941216
UniProt	P01897\|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]