Structure of PDB 3d1n Chain P Binding Site BS01

Receptor Information
>3d1n Chain P (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMEEIREFAKNFKIRRLSLGLTQTQVGQAMTATEGPAYSQSAISRFEKLD
ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d1n Structure of human Brn-5 transcription factor in complex with CRH gene promoter.
Resolution2.51 Å
Binding residue
(original residue number in PDB)		T164 Q165 T166 Q182 S186 R187 K190
Binding residue
(residue number reindexed from 1)		T22 Q23 T24 Q40 S44 R45 K48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3d1n, PDBe:3d1n, PDBj:3d1n
PDBsum3d1n
PubMed19450691
UniProtQ14863|PO6F1_HUMAN POU domain, class 6, transcription factor 1 (Gene Name=POU6F1)

[Back to BioLiP]