Structure of PDB 2d2c Chain P Binding Site BS01

Receptor Information

>2d2c Chain P (length=286) Species: 83541 (Mastigocladus laminosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVV
KIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGD
VYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIH
LGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQ
TDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQ
DPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAE

Ligand information

>2d2c Chain T (length=27) Species: 83541 (Mastigocladus laminosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LVLGLVFATLGGLFYAAYQQYKRPNEL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2d2c Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
Resolution	3.8 Å
Binding residue (original residue number in PDB)	Q38 M258 I259 M266 Q269 L270 I273 K277 Q278 E280
Binding residue (residue number reindexed from 1)	Q38 M258 I259 M266 Q269 L270 I273 K277 Q278 E280

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2d2c, PDBe:2d2c, PDBj:2d2c
PDBsum	2d2c
PubMed	16371475
UniProt	P83793\|CYF_MASLA Cytochrome f (Gene Name=petA)

[Back to BioLiP]