Structure of PDB 1skn Chain P Binding Site BS01

Receptor Information
>1skn Chain P (length=74) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKI
RRRGKNKVAARTCRQRRTDRHDKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1skn A new DNA-binding motif in the Skn-1 binding domain-DNA complex.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K460 R507 R508 N511 R516 R519
Binding residue
(residue number reindexed from 1)		K5 R52 R53 N56 R61 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1skn, PDBe:1skn, PDBj:1skn
PDBsum1skn
PubMed9628487
UniProtP34707|SKN1_CAEEL Protein skinhead-1 (Gene Name=skn-1)

[Back to BioLiP]