Structure of PDB 1sj4 Chain P Binding Site BS01

Receptor Information
>1sj4 Chain P (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG
QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>1sj4 Chain R (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uggccggcauggucccagccuccucgcuggcgccggcugggcaacaccau
ugcacuccgguggugaaugggac
.<<<<<<<...((((((<<<.((.....>>>>>>>>>>))....<<<<..
........>>>>.....))))))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sj4 A Conformational Switch controls hepatitis delta virus ribozyme catalysis
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 L49 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y10 N12 N13 E16 K19 L46 K47 M48 R49 Q51 F53 K77 Q82 A84 K85 T86 D87 S88 D89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1sj4, PDBe:1sj4, PDBj:1sj4
PDBsum1sj4
PubMed15141216
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]