Structure of PDB 1nk3 Chain P Binding Site BS01

Receptor Information
>1nk3 Chain P (length=63) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWF
QNHRYKTKRAQNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nk3 Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
ResolutionN/A
Binding residue
(original residue number in PDB)		R105 V106 F108 Q144 I147 N151
Binding residue
(residue number reindexed from 1)		R6 V7 F9 Q45 I48 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nk3, PDBe:1nk3, PDBj:1nk3
PDBsum1nk3
PubMed9154919
UniProtP22808|VND_DROME Homeobox protein vnd (Gene Name=vnd)

[Back to BioLiP]