Structure of PDB 1nk2 Chain P Binding Site BS01

Receptor Information

>1nk2 Chain P (length=77) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTP
TQVKIWFQNHRYKTKRAQNEKGYEGHP

Ligand information

>1nk2 Chain A (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgtgtcaagtggctgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nk2 Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
Resolution	N/A
Binding residue (original residue number in PDB)	K109 K111 R113 V114 Q152 I155 N159 K163
Binding residue (residue number reindexed from 1)	K9 K11 R13 V14 Q52 I55 N59 K63
Binding affinity	PDBbind-CN: Kd=0.19nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nk2, PDBe:1nk2, PDBj:1nk2
PDBsum	1nk2
PubMed	9154919
UniProt	P22808\|VND_DROME Homeobox protein vnd (Gene Name=vnd)

[Back to BioLiP]