Structure of PDB 1lfu Chain P Binding Site BS01

Receptor Information
>1lfu Chain P (length=82) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVS
NWFGNKRIRYKKNIGKFQEEANIYAAKTAVTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lfu Lock and Key Binding of the HOX YPWM Peptide to the PBX Homeodomain
ResolutionN/A
Binding residue
(original residue number in PDB)		R3 K4 R5 F8
Binding residue
(residue number reindexed from 1)		R4 K5 R6 F9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lfu, PDBe:1lfu, PDBj:1lfu
PDBsum1lfu
PubMed12409300
UniProtP41778|PBX1_MOUSE Pre-B-cell leukemia transcription factor 1 (Gene Name=Pbx1)

[Back to BioLiP]