Structure of PDB 1f5e Chain P Binding Site BS01

Receptor Information
>1f5e Chain P (length=65) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRWNKD
CTFNWLSSQRSKNSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f5e The solution structure of an AlcR-DNA complex sheds light onto the unique tight and monomeric DNA binding of a Zn(2)Cys(6) protein.
ResolutionN/A
Binding residue
(original residue number in PDB)		R5 G18 K19 R44 W45
Binding residue
(residue number reindexed from 1)		R7 G20 K21 R46 W47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f5e, PDBe:1f5e, PDBj:1f5e
PDBsum1f5e
PubMed11566132
UniProtP21228|ALCR_EMENI Regulatory protein alcR (Gene Name=alcR)

[Back to BioLiP]