Structure of PDB 1f4s Chain P Binding Site BS01

Receptor Information
>1f4s Chain P (length=65) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRWNKD
CTFNWLSSQRSKNSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f4s The solution structure of an AlcR-DNA complex sheds light onto the unique tight and monomeric DNA binding of a Zn(2)Cys(6) protein.
ResolutionN/A
Binding residue
(original residue number in PDB)		S0 M1 T4 R5 G18 K19 R44 W45
Binding residue
(residue number reindexed from 1)		S2 M3 T6 R7 G20 K21 R46 W47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f4s, PDBe:1f4s, PDBj:1f4s
PDBsum1f4s
PubMed11566132
UniProtP21228|ALCR_EMENI Regulatory protein alcR (Gene Name=alcR)

[Back to BioLiP]