Structure of PDB 1dzw Chain P Binding Site BS01

Receptor Information

>1dzw Chain P (length=206) Species: 562 (Escherichia coli)

MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKL
TESHIVFIDGNGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTA
VSILNRSIPAIHYMIAAAGGNSIPCAPYATAGTRELSEHVALALKNRKAT
LLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIA
VVLEKF

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1dzw Chain P Residue 999

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1dzw Catalytic Action of Fuculose 1-Phosphate Aldolase (Class II) as Derived from Structure-Directed Mutagenesis
• Resolution: 2.17 Å
• Binding residue (original residue number in PDB): E73 H92 H94 H155
• Binding residue (residue number reindexed from 1): E73 H92 H94 H155
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 4.1.2.17: L-fuculose-phosphate aldolase.

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0008738 L-fuculose-phosphate aldolase activity
• GO:0016829 lyase activity
• GO:0016830 carbon-carbon lyase activity
• GO:0016832 aldehyde-lyase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0005996 monosaccharide metabolic process
• GO:0006004 fucose metabolic process
• GO:0019317 fucose catabolic process
• GO:0019323 pentose catabolic process
• GO:0019568 arabinose catabolic process
• GO:0019571 D-arabinose catabolic process
• GO:0042355 L-fucose catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1dzw, PDBe:1dzw, PDBj:1dzw
• PDBsum: 1dzw
• PubMed: 10821675
• UniProt: P0AB87|FUCA_ECOLI L-fuculose phosphate aldolase (Gene Name=fucA)