Structure of PDB 1dp7 Chain P Binding Site BS01

Receptor Information
>1dp7 Chain P (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSV
FMGLRTRRLGTRGNSKYHYYGLRIKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dp7 Structure of the winged-helix protein hRFX1 reveals a new mode of DNA binding.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		R19 A41 K45 R48 R58 Y67 Y69
Binding residue
(residue number reindexed from 1)		R19 A41 K45 R48 R58 Y67 Y69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dp7, PDBe:1dp7, PDBj:1dp7
PDBsum1dp7
PubMed10706293
UniProtP22670|RFX1_HUMAN MHC class II regulatory factor RFX1 (Gene Name=RFX1)

[Back to BioLiP]