Structure of PDB 1ahd Chain P Binding Site BS01

Receptor Information

>1ahd Chain P (length=68) Species: 7241 (Drosophila subobscura) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWF
QNRRMKWKKENKTKGEPG

Ligand information

>1ahd Chain A (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaaagccattagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ahd Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex.
Resolution	N/A
Binding residue (original residue number in PDB)	R1 K2 R3 G4 R5 Y25 L26 R28 R31 K46 Q50 R53 M54 K57 K58
Binding residue (residue number reindexed from 1)	R2 K3 R4 G5 R6 Y26 L27 R29 R32 K47 Q51 R54 M55 K58 K59

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ahd, PDBe:1ahd, PDBj:1ahd
PDBsum	1ahd
PubMed	7903398
UniProt	Q24645\|ANTP_DROSU Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]