Structure of PDB 8ckb Chain O014 Binding Site BS01

Receptor Information

>8ckb Chain O014 (length=188) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MHFNELRISQDNRFLIIDVSVDNQDYFEDVLLDSIVIDTQDTFVMNGPSD
NPLYIYNVEDAYDTQQMKNVRLELNIQDLKVSPCSTMFFVYVKSKGTPST
DTPCGFDKDQILGTVINLQPIYKQTLKYLKEVECDCNIPKGFIDMILKLK
AIELCVRTGNYPQAIKYWNKFFIKNNCKSPTSNCGCYG

Ligand information

>8ckb Chain N024 (length=19) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MFFTQEDYRKIEKWLLANS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ckb Structural atlas of the most abundant human gut virus
Resolution	4.39 Å
Binding residue (original residue number in PDB)	Q24 D25 Y26 D128
Binding residue (residue number reindexed from 1)	Q24 D25 Y26 D101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0019058	viral life cycle
GO:0051701	biological process involved in interaction with host

	Cellular Component
GO:0044423	virion component

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum	8ckb
PubMed
UniProt	A0A385DVT1

[Back to BioLiP]