Structure of PDB 8ckb Chain O013 Binding Site BS01

Receptor Information

>8ckb Chain O013 (length=177) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MHFNELRISQDNRFLIIDVSVDNQDYFEDVLLDSIVIDTQDTFVMNGPSD
NPLYIYNVEDAYDTQQMKNVRLELNIQDLKVSPCSTMFFVYVKSKGTPST
DTPCGFDKDQILGTVINLQPIYKQTLKYLKEVECDCNIPKGFIDMILKLK
AIELCVRTGNYPQAIKYWNKFFIKNNC

Ligand information

>8ckb Chain N002 (length=19) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MFFTQEDYRKIEKWLLANS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ckb Structural atlas of the most abundant human gut virus
Resolution	4.39 Å
Binding residue (original residue number in PDB)	N46 P48 K120
Binding residue (residue number reindexed from 1)	N46 P48 K93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0019058	viral life cycle
GO:0051701	biological process involved in interaction with host

	Cellular Component
GO:0044423	virion component

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum	8ckb
PubMed
UniProt	A0A385DVT1

[Back to BioLiP]