Structure of PDB 8yhd Chain O Binding Site BS01

Receptor Information
>8yhd Chain O (length=190) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTRPCGRCVTCSLFGSMGRAGRASVDFLIS
NDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISNPQEK
DLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATD
Ligand information
>8yhd Chain M (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuua
agu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhd Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		G21 E22 V23 K28 F37 R40 P50 K52 G53 R56 S57 F90 G91 S92 M93 R95 A96 T118 H119 L120 R121 I122 R124 K127 F133 G175 W176 N178
Binding residue
(residue number reindexed from 1)		G20 E21 V22 K27 F36 R39 P49 K51 G52 R55 S56 F84 G85 S86 M87 R89 A90 T112 H113 L114 R115 I116 R118 K121 F127 G169 W170 N172
External links