Structure of PDB 8osl Chain O Binding Site BS01

Receptor Information
>8osl Chain O (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKH
KETTAQS
Ligand information
>8osl Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcacgtggaccacaaacgtgaagggtgaggctggaggaaaggcgtggctt
tcaaagtccctctcccctcaaggtcctggacacactacaaacccagagtt
gaagcttgggttgcataacggatccaggaacaaagtcggggtggggg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8osl Cooperation between bHLH transcription factors and histones for DNA access.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		N40 K44
Binding residue
(residue number reindexed from 1)		N6 K10
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0032922 circadian regulation of gene expression
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8osl, PDBe:8osl, PDBj:8osl
PDBsum8osl
PubMed37407816
UniProtO08785|CLOCK_MOUSE Circadian locomoter output cycles protein kaput (Gene Name=Clock)

[Back to BioLiP]