Structure of PDB 8ooa Chain O Binding Site BS01

Receptor Information
>8ooa Chain O (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN
IQAVLLPKK
Ligand information
>8ooa Chain K (length=102) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagcaagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
ga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ooa Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling.
Resolution3.18 Å
Binding residue
(original residue number in PDB)		R11 A14 R17 R32 R42
Binding residue
(residue number reindexed from 1)		R1 A4 R7 R22 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ooa, PDBe:8ooa, PDBj:8ooa
PDBsum8ooa
PubMed37384673
UniProtQ93077|H2A1C_HUMAN Histone H2A type 1-C (Gene Name=H2AC6)

[Back to BioLiP]