Structure of PDB 8ip0 Chain O Binding Site BS01

Receptor Information
>8ip0 Chain O (length=241) Species: 1147 (Synechocystis sp. PCC 6714) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLNLFATILTYPAQKILKDGQKYAIISPESMRNALREMLIELGQPNNRTR
LHLAVEFKEYPNPDKFADDFLFGYMVAQTNDAKEMKKLNRPAKRDSIFRC
NMAVAVNPYKYTAFQYPFALAGKDCAAKPEWVKALLQAIAELNGVAGGHA
RAYYEFAPRSVVARLTPKLVAGYQTYGFDAEGNWLELSRLTATDSDNLDL
PANEFWLGGELVRKMDQEQKAQLEAMGAPEKLFADLADSFL
Ligand information
>8ip0 Chain F (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agagcacuuuuaucaccguguccccaaucuggauauuuugugug
............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ip0 Cryo-EM structure of type I-B Cascade bound to a PAM-containing dsDNA target at 3.6 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		E47 R50 N51 H70 Y96 R116
Binding residue
(residue number reindexed from 1)		E29 R32 N33 H52 Y74 R94
Enzymatic activity
Enzyme Commision number ?
External links