Structure of PDB 8i0p Chain O Binding Site BS01

Receptor Information
>8i0p Chain O (length=271) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMR
FKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNK
EYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHH
EKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITT
LYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVA
AEKSFNKLIVNGRRLNVKWGR
Ligand information
>8i0p Chain F (length=95) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcg
<<<<<.<<<..>>>>>>>>...............................
...........<<<.....>>>.......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0p Molecular Basis for the activation of Human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R62 M63 H163
Binding residue
(residue number reindexed from 1)		R48 M49 H149
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0042307 positive regulation of protein import into nucleus
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046827 positive regulation of protein export from nucleus
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0p, PDBe:8i0p, PDBj:8i0p
PDBsum8i0p
PubMed39068178
UniProtQ9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)

[Back to BioLiP]