Structure of PDB 8evj Chain O Binding Site BS01

Receptor Information

>8evj Chain O (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKC
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVL

Ligand information

>8evj Chain J (length=138) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaataggaaccccacatgccctgtgtctgcaagtacagaactagccag
acagactgacctatttttgtgaggggaatcgggaagtatccattgctaag
actcagcaatgctgcaactctcagcaaccagctgaaga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8evj Structural basis of cooperative targeting of the CX3CR1 nucleosome
Resolution	4.1 Å
Binding residue (original residue number in PDB)	S205 K208 R232 R235
Binding residue (residue number reindexed from 1)	S35 K38 R62 R65

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	cis-regulatory region sequence-specific DNA binding
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0003700	DNA-binding transcription factor activity
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0042826	histone deacetylase binding
GO:0043565	sequence-specific DNA binding
GO:0051525	NFAT protein binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297	DNA-binding transcription factor binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001944	vasculature development
GO:0002314	germinal center B cell differentiation
GO:0002316	follicular B cell differentiation
GO:0002320	lymphoid progenitor cell differentiation
GO:0002327	immature B cell differentiation
GO:0002572	pro-T cell differentiation
GO:0002573	myeloid leukocyte differentiation
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0007179	transforming growth factor beta receptor signaling pathway
GO:0010628	positive regulation of gene expression
GO:0010629	negative regulation of gene expression
GO:0030098	lymphocyte differentiation
GO:0030218	erythrocyte differentiation
GO:0030225	macrophage differentiation
GO:0030851	granulocyte differentiation
GO:0031663	lipopolysaccharide-mediated signaling pathway
GO:0035019	somatic stem cell population maintenance
GO:0043011	myeloid dendritic cell differentiation
GO:0043314	negative regulation of neutrophil degranulation
GO:0045347	negative regulation of MHC class II biosynthetic process
GO:0045579	positive regulation of B cell differentiation
GO:0045815	transcription initiation-coupled chromatin remodeling
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051090	regulation of DNA-binding transcription factor activity
GO:0060033	anatomical structure regression
GO:0090402	oncogene-induced cell senescence
GO:0098508	endothelial to hematopoietic transition
GO:0120186	negative regulation of protein localization to chromatin
GO:1900745	positive regulation of p38MAPK cascade
GO:1902262	apoptotic process involved in blood vessel morphogenesis
GO:1902895	positive regulation of miRNA transcription
GO:1904151	positive regulation of microglial cell mediated cytotoxicity
GO:1904178	negative regulation of adipose tissue development
GO:1904238	pericyte cell differentiation
GO:1905036	positive regulation of antifungal innate immune response
GO:1905453	regulation of myeloid progenitor cell differentiation
GO:2000529	positive regulation of myeloid dendritic cell chemotaxis

	Cellular Component
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005667	transcription regulator complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8evj, PDBe:8evj, PDBj:8evj
PDBsum	8evj
PubMed	38267599
UniProt	P17433\|SPI1_MOUSE Transcription factor PU.1 (Gene Name=Spi1)

[Back to BioLiP]