Structure of PDB 8evi Chain O Binding Site BS01

Receptor Information
>8evi Chain O (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKC
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVL
Ligand information
>8evi Chain J (length=143) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaataggaaccccacatgccctgtgtctgcaagtacagaactagccag
acagactgacctatttttgtgaggggaatcgggaagtatccattgctaag
actcagcaatgctgcaactctcagcaaccagctgaagatcagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8evi Structural basis of cooperative targeting of the CX3CR1 nucleosome
Resolution2.64 Å
Binding residue
(original residue number in PDB)		S205 K208 R235 K245 L250
Binding residue
(residue number reindexed from 1)		S35 K38 R65 K75 L80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042826 histone deacetylase binding
GO:0043565 sequence-specific DNA binding
GO:0051525 NFAT protein binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
GO:0140311 protein sequestering activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001944 vasculature development
GO:0002314 germinal center B cell differentiation
GO:0002316 follicular B cell differentiation
GO:0002320 lymphoid progenitor cell differentiation
GO:0002327 immature B cell differentiation
GO:0002572 pro-T cell differentiation
GO:0002573 myeloid leukocyte differentiation
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0030098 lymphocyte differentiation
GO:0030218 erythrocyte differentiation
GO:0030225 macrophage differentiation
GO:0030851 granulocyte differentiation
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0035019 somatic stem cell population maintenance
GO:0043011 myeloid dendritic cell differentiation
GO:0043314 negative regulation of neutrophil degranulation
GO:0045347 negative regulation of MHC class II biosynthetic process
GO:0045579 positive regulation of B cell differentiation
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051090 regulation of DNA-binding transcription factor activity
GO:0060033 anatomical structure regression
GO:0090402 oncogene-induced cell senescence
GO:0098508 endothelial to hematopoietic transition
GO:0120186 negative regulation of protein localization to chromatin
GO:1900745 positive regulation of p38MAPK cascade
GO:1902262 apoptotic process involved in blood vessel morphogenesis
GO:1902895 positive regulation of miRNA transcription
GO:1904151 positive regulation of microglial cell mediated cytotoxicity
GO:1904178 negative regulation of adipose tissue development
GO:1904238 pericyte cell differentiation
GO:1905036 positive regulation of antifungal innate immune response
GO:1905453 regulation of myeloid progenitor cell differentiation
GO:2000529 positive regulation of myeloid dendritic cell chemotaxis
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8evi, PDBe:8evi, PDBj:8evi
PDBsum8evi
PubMed38267599
UniProtP17433|SPI1_MOUSE Transcription factor PU.1 (Gene Name=Spi1)

[Back to BioLiP]