Structure of PDB 8euj Chain O Binding Site BS01

Receptor Information
>8euj Chain O (length=81) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVT
YTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8euj Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggaatccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euj Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		T30 P32 R36
Binding residue
(residue number reindexed from 1)		T9 P11 R15
External links