Structure of PDB 8bzl Chain O Binding Site BS01

Receptor Information

>8bzl Chain O (length=221) Species: 9606 (Homo sapiens)

RGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKLYD
ERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTA
QLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAW
KATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFMTEDNIEVG
ICNEAGFRRLTPTEVKDYLAA

Ligand information

>8bzl Chain e (length=3) Species: 32630 (synthetic construct)

YYS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8bzl Peptidic, Blm10-based activators of human 20S proteasome in vitro and in cellulo enhance degradation of proteins connected with neurodegeneration.
• Resolution: 2.14 Å
• Binding residue (original residue number in PDB): G16 K17 E22 S151
• Binding residue (residue number reindexed from 1): G14 K15 E20 S144

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0006511 ubiquitin-dependent protein catabolic process
• GO:0009615 response to virus
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0000932 P-body
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005839 proteasome core complex
• GO:0019773 proteasome core complex, alpha-subunit complex
• GO:0034774 secretory granule lumen
• GO:0070062 extracellular exosome
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:8bzl, PDBe:8bzl, PDBj:8bzl
• PDBsum: 8bzl
• UniProt: P25787|PSA2_HUMAN Proteasome subunit alpha type-2 (Gene Name=PSMA2)