Structure of PDB 8bvh Chain O Binding Site BS01

Receptor Information
>8bvh Chain O (length=69) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQ
MVYKHAISTVVPSRPVRLP
Ligand information
>8bvh Chain A (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaauaacaacaagauuuuaaaauccagcagcaacgacaccgaacuac
.................<<<>>>..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bvh Translational regulation by Hfq-Crc assemblies emerges from polymorphic ribonucleoprotein folding.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
Y25 G29 I30 K31 L32 Q33 N48 Q52 S60 T61
Binding residue
(residue number reindexed from 1)
Y23 G27 I28 K29 L30 Q31 N46 Q50 S58 T59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0043487 regulation of RNA stability
GO:0043609 regulation of carbon utilization
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8bvh, PDBe:8bvh, PDBj:8bvh
PDBsum8bvh
PubMed36504222
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]