Structure of PDB 7vpx Chain O Binding Site BS01

Receptor Information
>7vpx Chain O (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDP
RDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDA
FKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEY
EHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRR
G
Ligand information
>7vpx Chain L (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacuuaccuggcaggggagauaccaugaucacgaaggugguuuucccag
ggcgaggcuuauccauugcacuccggaugugcugaccccugcgauuuccc
caaaugugggaaacucgacugcauaauuugugguagugggggacugcguu
cgcgcuuuccccug
...........<<<<.<<<<<.<<<<<..........>>>>>>>>>>.<<
<<...<<<.<<<<<..........>>>>>.>>>...>>>>.<<<<<<<<<
.......>>>>>>.>>>.>>>>...............<<<<<<..<<<..
..>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vpx Mechanism for Branch Site Recognition and Proofreading During Prespliceosome Assembly
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K32 H33 H34 P37 Y38 M67 R71 K74 F106 A108 R109 Y112 H133 V135 Y136 S137 K138 R139 R144 Y146 F148 L175 T199 R200
Binding residue
(residue number reindexed from 1)		K31 H32 H33 P36 Y37 M66 R70 K73 F105 A107 R108 Y111 H132 V134 Y135 S136 K137 R138 R143 Y145 F147 L174 T198 R199
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0043462 regulation of ATP-dependent activity
GO:0043484 regulation of RNA splicing
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0061084 negative regulation of protein refolding
GO:1904715 negative regulation of chaperone-mediated autophagy
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vpx, PDBe:7vpx, PDBj:7vpx
PDBsum7vpx
PubMed38196034
UniProtP08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa (Gene Name=SNRNP70)

[Back to BioLiP]