Structure of PDB 7r5v Chain O Binding Site BS01

Receptor Information
>7r5v Chain O (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVLAHLERLETQNEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCI
STAFEGNLLDSYFVDLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHF
LFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQRNPLCNLLSFTYKLDQ
SFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKP
LHQVFASFTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r5v Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
Resolution4.55 Å
Binding residue
(original residue number in PDB)		K146 I173
Binding residue
(residue number reindexed from 1)		K70 I97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007059 chromosome segregation
GO:0034508 centromere complex assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000939 inner kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0016604 nuclear body
GO:0031511 Mis6-Sim4 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r5v, PDBe:7r5v, PDBj:7r5v
PDBsum7r5v
PubMed35420891
UniProtQ9BU64|CENPO_HUMAN Centromere protein O (Gene Name=CENPO)

[Back to BioLiP]