Structure of PDB 7o3e Chain O Binding Site BS01

Receptor Information

>7o3e Chain O (length=240) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRH
LVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEA
ARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFN
PYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDH
RKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPP

Ligand information

>7o3e Chain P (length=15) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SHTDVKVPDFSDYRR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7o3e Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	S232 K234 R238
Binding residue (residue number reindexed from 1)	S232 K234 R238

Enzymatic activity

Enzyme Commision number

7.1.1.8: quinol--cytochrome-c reductase.

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding

View graph for
Molecular Function

External links

PDB	RCSB:7o3e, PDBe:7o3e, PDBj:7o3e
PDBsum	7o3e
PubMed	34616041
UniProt	Q9D0M3\|CY1_MOUSE Cytochrome c1, heme protein, mitochondrial (Gene Name=Cyc1)

[Back to BioLiP]