Structure of PDB 7m50 Chain O Binding Site BS01

Receptor Information

>7m50 Chain O (length=150) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGS
LFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEF
EGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Ligand information

>7m50 Chain P (length=7) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaaa

.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7m50 Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts.
Resolution	2.31 Å
Binding residue (original residue number in PDB)	R39 R79 S155
Binding residue (residue number reindexed from 1)	R30 R70 S146

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:7m50, PDBe:7m50, PDBj:7m50
PDBsum	7m50
PubMed	34866603
UniProt	P17574\|COAT_STMV Coat protein

[Back to BioLiP]