Structure of PDB 7etj Chain O Binding Site BS01

Receptor Information
>7etj Chain O (length=69) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVTMDRVRKRYLR
QELRDLGHRVQTYCEDLEG
Ligand information
>7etj Chain H (length=20) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRQLAQSVQDTIQHMRFLYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7etj Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		Y60 Q63 E64 D67
Binding residue
(residue number reindexed from 1)		Y48 Q51 E52 D55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
Cellular Component
GO:0019028 viral capsid

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7etj, PDBe:7etj, PDBj:7etj
PDBsum7etj
PubMed34315863
UniProtA0A3G6XKK5

[Back to BioLiP]