Structure of PDB 7aqq Chain O Binding Site BS01

Receptor Information
>7aqq Chain O (length=122) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKKVSDRIVKLSAIDPDGYKQDIIGLSGQTLLRALTHTGLIDPASHRLD
DIEACSAECEVQIAEEWLEKLPPRTYDEEYVLKRSSRSRILNKHSRLGCQ
VVLTQELQGMVVAVPEAKPWDI
Ligand information
>7aqq Chain L (length=26) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DKGAIEILGPYGISYTFRRLAERISQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aqq A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		Y112 Y116
Binding residue
(residue number reindexed from 1)		Y76 Y80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0140647 P450-containing electron transport chain
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aqq, PDBe:7aqq, PDBj:7aqq
PDBsum7aqq
PubMed33768254
UniProtQ9SRR8

[Back to BioLiP]