Structure of PDB 6z7n Chain O Binding Site BS01

Receptor Information

>6z7n Chain O (length=267) Species: 10524 (Human adenovirus 41) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PAMLAALQSQPDWAAAMDRILALTTRNPEAFRQQPQANRFSAILEAVVPS
RTNPTHEKVLAIVNALTESKAIRKDEAGLIYNALLERVARYNSTNVQANL
DRLTTDVREAVAQRERFMHDTNLGSQVALNAFLSTLPANVPRGQEDYVSF
ISALRLLVAEVPQSEVYQSGPDYFFQTSRQGLQTVNLTQAFKNLQGMWGV
RSLLTPNTRLLLLLIAPFTNSSTISRDSYLGHLITLYREAIGQTQVDEQT
FQEITSVSDTGSLEATL

Ligand information

>6z7n Chain W (length=9) Species: 10524 (Human adenovirus 41) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6z7n The structure of enteric human adenovirus 41-A leading cause of diarrhea in children.
Resolution	3.77 Å
Binding residue (original residue number in PDB)	Q55 P57
Binding residue (residue number reindexed from 1)	Q33 P35

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0019028	viral capsid
GO:0042025	host cell nucleus
GO:0098021	viral capsid, decoration

View graph for
Cellular Component

External links

PDB	RCSB:6z7n, PDBe:6z7n, PDBj:6z7n
PDBsum	6z7n
PubMed	33523995
UniProt	Q67716

[Back to BioLiP]