Structure of PDB 6nue Chain O Binding Site BS01

Receptor Information
>6nue Chain O (length=212) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFAKIKFSAQIRLETGLHIGGSDAFAAIGAIDSPVIKDPITNIPIIPGSS
LKGKMRTLLAKVYNEKVAEKPSDDSDILSRLFGNSKDKRFKMGRLIFRDA
FLSNADELDSLGVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFEL
IYEITDENENQVEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFEKLKAT
TVFGNYDVKTLN
Ligand information
>6nue Chain H (length=40) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacuuucguaacuguuuaauucuguucacuuauuc
........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nue Coupling of ssRNA cleavage with DNase activity in type III-A CRISPR-Csm revealed by cryo-EM and biochemistry.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		G21 S34 S50 S51 G54 K55 R57 S73 S86 K92 M93 F122 N124 T125 I126 A131 E132 R136 Y181 G183 G184 S185 S187
Binding residue
(residue number reindexed from 1)		G20 S33 S49 S50 G53 K54 R56 S72 S85 K91 M92 F121 N123 T124 I125 A130 E131 R135 Y180 G182 G183 S184 S186
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6nue, PDBe:6nue, PDBj:6nue
PDBsum6nue
PubMed30814678
UniProtA0A0A7HIF0|CSM3_STRTR CRISPR system Cms endoribonuclease Csm3 (Gene Name=csm3)

[Back to BioLiP]