Structure of PDB 6id1 Chain O Binding Site BS01

Receptor Information
>6id1 Chain O (length=290) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRM
RFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVN
KEYYTQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPH
ICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKL
LKRASTMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITV
VQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWG
Ligand information
>6id1 Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6id1 Structures of the human spliceosomes before and after release of the ligated exon.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		R35 E39 R56 F65 C165 S166 F167 E172 K174 R175 P180 Y181
Binding residue
(residue number reindexed from 1)		R22 E26 R43 F52 C152 S153 F154 E159 K161 R162 P167 Y168
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0042307 positive regulation of protein import into nucleus
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046827 positive regulation of protein export from nucleus
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6id1, PDBe:6id1, PDBj:6id1
PDBsum6id1
PubMed30728453
UniProtQ9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)

[Back to BioLiP]