Structure of PDB 6ff4 Chain O Binding Site BS01

Receptor Information
>6ff4 Chain O (length=253) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDEEELNDYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSI
YERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWDRAITTLPRVNQFWY
KYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVDRART
IYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEH
LYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGD
RRG
Ligand information
>6ff4 Chain 6 (length=95) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcg
<<<<<.<<....>>>>>>>...............................
......<<...<<<.....>>>....>>.................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ff4 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		N234 R236 K237 K247 Y318 Q344 H347 S348 N351
Binding residue
(residue number reindexed from 1)		N20 R22 K23 K33 Y104 Q130 H133 S134 N137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ff4, PDBe:6ff4, PDBj:6ff4
PDBsum6ff4
PubMed29361316
UniProtQ9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 (Gene Name=CRNKL1)

[Back to BioLiP]