Structure of PDB 6b1t Chain O Binding Site BS01

Receptor Information
>6b1t Chain O (length=180) Species: 28285 (Human adenovirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKEIPTPYMWSYQPQMGLAAGAAQDYSTRINYMSAGPHMISRVNGIRAHR
NRILLEQAAITTTPRNNLNPRSWPAALVYQESPAPTTVVLPRDAQAEVQM
TNSGAQLAGGGRPSFTPRQAILTLQTSSSEPRSGGIGTLQFIEEFVPSVY
FNPFSGPPGHYPDQFIPNFDAVKDSADGYD
Ligand information
>6b1t Chain Y (length=28) Species: 28285 (Human adenovirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FASLAPRHGSRPFMGNWQDIGTSNMSGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b1t Atomic Structures of Minor Proteins VI and VII in Human Adenovirus.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		P205 Y208
Binding residue
(residue number reindexed from 1)		P158 Y161
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6b1t, PDBe:6b1t, PDBj:6b1t
PDBsum6b1t
PubMed28978703
UniProtP24936|CAP8_ADE05 Pre-hexon-linking protein VIII (Gene Name=L4)

[Back to BioLiP]