Structure of PDB 6ah0 Chain O Binding Site BS01

Receptor Information

>6ah0 Chain O (length=139) Species: 9606 (Homo sapiens)

SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK
VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK
INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY

Ligand information

>6ah0 Chain B (length=115)

acucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagau
uuccguggagaggaacaacucugagucuuaacccaauuuuuugaggccuu
gcuuuggcaaggcua

.<<<...<<<<<<<<<<........<<<<<<<<.<.......>.>>>>>>
>>...>>>>>>>>>>.......>>>...................<<<<<<
<<....>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ah0 Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
• Resolution: 5.7 Å
• Binding residue (original residue number in PDB): T138 K139 Y140
• Binding residue (residue number reindexed from 1): T137 K138 Y139

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000375 RNA splicing, via transesterification reactions
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0051301 cell division

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005829 cytosol
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:6ah0, PDBe:6ah0, PDBj:6ah0
• PDBsum: 6ah0
• PubMed: 30315277
• UniProt: P83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)