Structure of PDB 5zia Chain O Binding Site BS01

Receptor Information
>5zia Chain O (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKVSCTASGYTFTGYYLHWVRQAPGQGLEWMGW
VNPRSGGTSYPPKFQGRVTMTRDTSINTAYMDLTWLTSDDTAVYYCAVGR
IPDVTAFDIWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKRVGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zia Structural Basis for Recognition of a Unique Epitope by a Human Anti-tau Antibody.
Resolution2.603 Å
Binding residue
(original residue number in PDB)		T30 G31 Y32 Y33 H35 W50 R53 G95 R96 I97 P98 D99 T100A
Binding residue
(residue number reindexed from 1)		T30 G31 Y32 Y33 H35 W50 R54 G99 R100 I101 P102 D103 T105
External links