Structure of PDB 5n7x Chain O Binding Site BS01

Receptor Information
>5n7x Chain O (length=122) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n7x Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.12 Å
Binding residue
(original residue number in PDB)		N118 W120 K121
Binding residue
(residue number reindexed from 1)		N105 W107 K108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n7x, PDBe:5n7x, PDBj:5n7x
PDBsum5n7x
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]