Structure of PDB 5d2l Chain O Binding Site BS01

Receptor Information
>5d2l Chain O (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVM
TLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFITGNQFYF
GTGTSLTVIPNIQNPDPAVYQLRDDKSVCLFTDFDSQTNVSDVYITDKCV
LDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d2l Structural Basis for Clonal Diversity of the Public T Cell Response to a Dominant Human Cytomegalovirus Epitope.
Resolution3.511 Å
Binding residue
(original residue number in PDB)		N29 Y31 T94 G95 N96
Binding residue
(residue number reindexed from 1)		N29 Y31 T94 G95 N96
External links