Structure of PDB 5bkn Chain O Binding Site BS01

Receptor Information

>5bkn Chain O (length=149) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSL
FSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFE
GRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Ligand information

>5bkn Chain P (length=7) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaaa

.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5bkn Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	V38 A40 S155
Binding residue (residue number reindexed from 1)	V28 A30 S145

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5bkn, PDBe:5bkn, PDBj:5bkn
PDBsum	5bkn
PubMed	34866603
UniProt	P17574\|COAT_STMV Coat protein

[Back to BioLiP]