Structure of PDB 4v1n Chain O Binding Site BS01

Receptor Information
>4v1n Chain O (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Ligand information
>4v1n Chain N (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacagtagcacgctgtgtatataatagtgtgttgtacagcacaactgcgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v1n Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
Resolution7.8 Å
Binding residue
(original residue number in PDB)
V71 T73 F116 S118 K120 V122 Q158 N159 F190 L205 T215
Binding residue
(residue number reindexed from 1)
V11 T13 F56 S58 K60 V62 Q98 N99 F130 L145 T155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4v1n, PDBe:4v1n, PDBj:4v1n
PDBsum4v1n
PubMed25652824
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]