Structure of PDB 3lrh Chain O Binding Site BS01

Receptor Information
>3lrh Chain O (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLM
YDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGW
VFGGGTKVTVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lrh A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		N35 I37 L47 Y50 D51 Y88 W99 F101
Binding residue
(residue number reindexed from 1)		N36 I38 L48 Y51 D52 Y89 W100 F102
External links