Structure of PDB 3d1n Chain O Binding Site BS01

Receptor Information

>3d1n Chain O (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NMEEIREFAKNFKIRRLSLGLTQTQVGQAMTATEGPAYSQSAISRFEKLD
ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFT
PQAIEALNAYFEKNPLPTGQEITEMAKELNYDREVVRVWFSNRRQTLKNT

Ligand information

>3d1n Chain G (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcataaataataa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3d1n Structure of human Brn-5 transcription factor in complex with CRH gene promoter.
Resolution	2.51 Å
Binding residue (original residue number in PDB)	R158 T164 Q165 Q182 S183 S186 K190 R235 K236 R238 T239 N284
Binding residue (residue number reindexed from 1)	R16 T22 Q23 Q40 S41 S44 K48 R93 K94 R96 T97 N142

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3d1n, PDBe:3d1n, PDBj:3d1n
PDBsum	3d1n
PubMed	19450691
UniProt	Q14863\|PO6F1_HUMAN POU domain, class 6, transcription factor 1 (Gene Name=POU6F1)

[Back to BioLiP]