Structure of PDB 2zp9 Chain O Binding Site BS01

Receptor Information
>2zp9 Chain O (length=41) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVIATDDLEVACPKCCPACSGKGVILTAQGYTLLDFIQKHL
Ligand information
>2zp9 Chain N (length=17) Species: 1423 (Bacillus subtilis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LTAQGYTLLDFIQKHLN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zp9 The nature of the TRAP-Anti-TRAP complex.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		M1 I3 T5 L8 E9 L36 G40 L44
Binding residue
(residue number reindexed from 1)		M1 I3 T5 L8 E9 L26 G30 L34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2zp9, PDBe:2zp9, PDBj:2zp9
PDBsum2zp9
PubMed19164760
UniProtO31466|RTPA_BACSU Tryptophan RNA-binding attenuator protein inhibitory protein (Gene Name=rtpA)

[Back to BioLiP]