Structure of PDB 2wwa Chain O Binding Site BS01

Receptor Information
>2wwa Chain O (length=37) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRY
Ligand information
>2wwa Chain D (length=63) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaacgcagcgaaaugcgauacguaaugugaauugcagaauuccgugaau
caucgaaucuuug
.<<<<<<........>>>.....<.<<....<<......>>.........
.>>..>...>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wwa Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
Resolution8.9 Å
Binding residue
(original residue number in PDB)		K12 K15 A16 Q19 R21 P22 W26 I27 R30
Binding residue
(residue number reindexed from 1)		K12 K15 A16 Q19 R21 P22 W26 I27 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wwa, PDBe:2wwa, PDBj:2wwa
PDBsum2wwa
PubMed19933108
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]