Structure of PDB 2wtt Chain O Binding Site BS01

Receptor Information
>2wtt Chain O (length=41) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQ
Ligand information
>2wtt Chain M (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DTYYLQVRGRENFEILMKLKESLELMELV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wtt Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L371 E373 S374 L375 L377 M378 Y389 R390 Q393
Binding residue
(residue number reindexed from 1)		L19 E21 S22 L23 L25 M26 Y37 R38 Q41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wtt, PDBe:2wtt, PDBj:2wtt
PDBsum2wtt
PubMed19815500
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]