Structure of PDB 1oau Chain O Binding Site BS01

Receptor Information
>1oau Chain O (length=92) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNN
RAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCGTKLTVL
Ligand information
>1oau Chain K (length=22) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GAVKRPAMVYYCARMDWGTTVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oau Antibody Multispecificity Mediated by Conformational Diversity
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F46 G48
Binding residue
(residue number reindexed from 1)		F41 G43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1oau, PDBe:1oau, PDBj:1oau
PDBsum1oau
PubMed12610298
UniProtP01724|LV1B_MOUSE Ig lambda-1 chain V regions MOPC 104E/RPC20/J558/S104

[Back to BioLiP]