Structure of PDB 8glv Chain Ny Binding Site BS01

Receptor Information
>8glv Chain Ny (length=32) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEATKRVEDQFKAKVNQTLSSTDPPVWHGRRK
Ligand information
>8glv Chain OZ (length=17) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FFGLTSFGPQDPVKDRV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8glv Axonemal structures reveal mechanoregulatory and disease mechanisms.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
V454 E455
Binding residue
(residue number reindexed from 1)
V7 E8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0003341 cilium movement
Cellular Component
GO:0031514 motile cilium

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8glv, PDBe:8glv, PDBj:8glv
PDBsum8glv
PubMed37258679
UniProtA8IRJ7|CFA53_CHLRE Cilia- and flagella-associated protein 53 (Gene Name=CFAP53)

[Back to BioLiP]